PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g446900.1
Common NameMTR_8g446900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 382aa    MW: 43477.2 Da    PI: 6.2659
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g446900.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.25.6e-2262162198
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f k lt+  ++++g l++pk++a+++       ++++  ++l+++d++g +W++++iy+ + ++++lt+GW+ Fv++++L+ gD+++F   + +
  Medtr8g446900.1  62 FSKLLTSMETSTQGGLYIPKQHADRCfpqldmTLQPPM-QDLVVKDLQGIEWNFRHIYCDHERAHLLTNGWNTFVNSKNLRPGDSCIFV--SGE 152
                      7788888899999***************9999666655.49************************************************..448 PP

                      EE..EEEEE- CS
               B3  89 efelvvkvfr 98 
                      ++e  ++++r
  Medtr8g446900.1 153 NGEIGIGIRR 162
                      8888888887 PP

2Auxin_resp71.13.3e-24190270183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      ++ha+s +s F+  Y+P+ ++ eF+++++ +++++++ +s+G+R+ m  e   +++r   Gt+vg +d+dp+rWp+S+Wr++k
  Medtr8g446900.1 190 VVHAVSIGSLFHLQYHPWIAPFEFMIPLKTYVESIEKDYSIGTRVHMLSEVGGCPRRY--GTIVGNEDIDPIRWPGSEWRCIK 270
                      689****************************************************997..*********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.85E-2652168IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-3058168IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-1761162No hitNo description
PfamPF023621.7E-1962163IPR003340B3 DNA binding domain
PROSITE profilePS5086313.60662164IPR003340B3 DNA binding domain
SMARTSM010198.3E-1762164IPR003340B3 DNA binding domain
PfamPF065075.6E-21190270IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEIPNYHLPS KILCIVVGVQ LMVKVDTDEI FTLVTLFPLL EQQEYVLEDN HALHSPDEIY  60
SFSKLLTSME TSTQGGLYIP KQHADRCFPQ LDMTLQPPMQ DLVVKDLQGI EWNFRHIYCD  120
HERAHLLTNG WNTFVNSKNL RPGDSCIFVS GENGEIGIGI RRAMKQHSHI CTKLCQQSSQ  180
NIQLGALAAV VHAVSIGSLF HLQYHPWIAP FEFMIPLKTY VESIEKDYSI GTRVHMLSEV  240
GGCPRRYGTI VGNEDIDPIR WPGSEWRCIK VQWDSMLNIE RVCPWWIEPL GSPKIMLKGI  300
PIFPLPNKTD VPNPSLLGLN NFANENITGS SSKPEYHKVD MDLEGQQYNT GNDKKSIFSI  360
FAFFICLCFF TFVIFVFRPL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A6e-78229263357Auxin response factor 1
4ldw_A6e-78229263357Auxin response factor 1
4ldw_B6e-78229263357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445290.10.0auxin response factor 14
TrEMBLA0A072TQ390.0A0A072TQ39_MEDTR; Auxin response factor
STRINGGLYMA19G39340.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2800423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.33e-82auxin response factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]